PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00067621001
Common NameGSBRNA2T00067621001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 244aa    MW: 27638.7 Da    PI: 9.1529
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00067621001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof101.74.4e-322177561
               zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          + cprC s+ntkfC+ynny ++qPry C++Crr+Wt+GGalr+vP+Gg +rk k+ 
  GSBRNA2T00067621001 21 PRVCPRCSSDNTKFCFYNNYRVTQPRYNCRNCRRFWTHGGALRDVPIGGRARKIKRI 77
                         678**************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-211676IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.0492276IPR003851Zinc finger, Dof-type
PfamPF027013.6E-292276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MDNSNVLVRG NRQVNEEKPP PRVCPRCSSD NTKFCFYNNY RVTQPRYNCR NCRRFWTHGG  60
ALRDVPIGGR ARKIKRIEQP SVSQVVPDEI QQVNHHQPFS HVQETTQFLE PFGGSYSSAV  120
VGNHFSPLPE THGDMMLPTR SIPPMDLFDG LFHQGYYGAG LNNFVGNHLM NQSIGGHVDN  180
YNSYRVNQEN PNMPNQSFTN TMIMNHNAGT SERRGYPGID HMNNNNNNKS VFRSSYQLGK  240
HGP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013614968.10.0PREDICTED: dof zinc finger protein DOF4.4-like
SwissprotQ9SUA94e-64DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078JM430.0A0A078JM43_BRANA; BnaCnng56790D protein
TrEMBLA0A0D2ZUL00.0A0A0D2ZUL0_BRAOL; Uncharacterized protein
STRINGBra013492.1-P1e-162(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.12e-65Dof-type zinc finger domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]